PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462844628
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 206aa    MW: 23671.6 Da    PI: 7.1792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462844628genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.81.4e-14252448
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHT......TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmg......kgRtlkqcksrwqkyl 48
                     W+++Ede+l+  ++ +G gtW+++a+         ++R++k+c++rw +yl
        462844628  2 WSPDEDERLYSHITNYGVGTWSSVAELASltilsgLKRSGKSCRLRWMNYL 52
                     *************************************************97 PP

2Myb_DNA-binding42.91.1e-136099344
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     + ++ E++l+v + k lG++ W+ Ia++m+ gRt++++k++w
        462844628 60 PISKKEEDLIVSLQKVLGNR-WSVIAARMP-GRTDNDIKNYW 99
                     66899***************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.766152IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-19259IPR009057Homeodomain-like
SuperFamilySSF466895.08E-26299IPR009057Homeodomain-like
CDDcd001673.54E-8252No hitNo description
SMARTSM007173.1E-5254IPR001005SANT/Myb domain
PfamPF002493.5E-12252IPR001005SANT/Myb domain
PROSITE profilePS5129421.05953107IPR017930Myb domain
SMARTSM007176.6E-1257105IPR001005SANT/Myb domain
CDDcd001673.77E-96099No hitNo description
Gene3DG3DSA:1.10.10.605.5E-2260107IPR009057Homeodomain-like
PfamPF002491.6E-116099IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
LWSPDEDERL YSHITNYGVG TWSSVAELAS LTILSGLKRS GKSCRLRWMN YLQPDLRKEP  60
ISKKEEDLIV SLQKVLGNRW SVIAARMPGR TDNDIKNYWS SRIKKKLRRM GANRDQSPET  120
SQTAEKSAYC NTEDGNLHVT KSHNNSANEK PHRHFPIFTC QLLTDERNCD QAAHYSSLSK  180
NNEMDLLVED YVDFLMSLPD DLHADI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-24210730128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101107RIKKKLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448905.13e-63hypothetical protein SORBIDRAFT_05g001215, partial
RefseqXP_008669936.11e-62PREDICTED: transcription factor MYB82-like isoform X1
SwissprotP200278e-45MYB3_HORVU; Myb-related protein Hv33
TrEMBLC5Y3I13e-63C5Y3I1_SORBI; Putative uncharacterized protein Sb05g001215 (Fragment)
STRINGSb05g001215.11e-62(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-46myb domain protein 61